Cat. No.: IBDP-531027
Size:
Online InquiryTarget Information
| Synonyms | Tumor necrosis factor receptor superfamily member 17|||B-cell maturation protein|||CD269|||Tnfrsf17|||Bcm|||Bcma |
| Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Function | B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein (HEK293, mFc) is a recombinant protein with a C-Terminal Fc label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | mFc |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 35-42 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |