Recombinant Human Bim Protein

Target Information

Sequence	MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSC DKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHS QDTEQLNHKDFS
Sequence Similarities	Belongs to the Bcl-2 family.
Amino Acids	1 to 112
Cellular Localization	Mitochondrion and Endomembrane system. Associated with intracytoplasmic membranes.
Tissue Specificity	Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are ubiquitously expressed with a tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.
Function	Induces apoptosis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than the isoforms BimEL, BimL and BimS. Isoform Bim-gamma induces apoptosis.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Tag	GST
Protein Length	Full length protein
Molecular Weight	39 kDa
Active	No
Animal free	No
Nature	Recombinant
Application	ELISA, SDS-PAGE, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.