Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human c-Jun Protein

Cat. No.: IBDP-531613

Size:

Target Information

Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK PHLRAKNSDLLTSPDVGLLKLASPELERL
Sequence Similarities Belongs to the bZIP family. Jun subfamily. Contains 1 bZIP (basic-leucine zipper) domain.
Amino Acids 1 to 79
Cellular Localization Nucleus.
Function Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306).

Product Details

Product Type Protein
Species Human
Source E. coli
Protein Length Protein fragment
Active No
Animal free No
Nature Recombinant
Application FuncS

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.