Recombinant Human C Reactive Protein

Target Information

Sequence	QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYS IFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSW ESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQ SLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFT KPQLWP
Sequence Similarities	Belongs to the pentaxin family. Contains 1 pentaxin domain.
Amino Acids	19 to 224
Cellular Localization	Secreted.
Tissue Specificity	Found in plasma.
Function	Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	24 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.