Recombinant Human CCL1 Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMKSMQVPFSRCCFSFAEQEIPLRAILCYRN TSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 96
Cellular Localization	Secreted.
Function	Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	11 kDa
Purity	>85%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.