Cat. No.: IBDP-531134
Size:
Online InquiryTarget Information
| Sequence | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRG HSVCTNPSDKWVQDYIKDMKEN |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 22 to 93 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. |
| Function | Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 9 kDa |
| Purity | ≥95% |
| Active | No |
| Animal free | Yes |
| Nature | Recombinant |
| Application | HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |