Cat. No.: IBDP-531607
Size:
Online InquiryTarget Information
| Sequence | QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICA DPNKKWVQKYISDLKLNA |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid. |
| Function | Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Protein Length | Full length protein |
| Molecular Weight | 10 kDa |
| Purity | >98% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |