Recombinant Human CCL28/MEC Protein

Target Information

Sequence	SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKR RRICVSPHNHTVKQWMKVQAAKKNGKGNVC HRKKHHGKRNSNRAHQGKHETYGHKTPY
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	20 to 127
Cellular Localization	Secreted.
Tissue Specificity	Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
Function	Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	12 kDa
Purity	>97%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.