Recombinant Human CCL4/MIP-1 beta Protein

Target Information

Sequence	APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQV CADPSESWVQEYVYDLELN
Sequence Similarities	Belongs to the intercrine beta (chemokine CC) family.
Amino Acids	24 to 92
Cellular Localization	Secreted.
Function	Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	<0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	8 kDa
Purity	≥95%
Active	No
Animal free	Yes
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.