Cat. No.: IBDP-530499
Size:
Online InquiryTarget Information
| Synonyms | C-C Motif Chemokine 5|||EoCP|||Eosinophil Chemotactic Cytokine|||SIS-Delta|||Small-Inducible Cytokine A5|||T Cell-Specific Protein P228|||TCP228|||T-Cell-Specific Protein RANTES|||CCL5|||D17S136E|||SCYA5 |
| Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Function | CCL5 Protein is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.CCL5 Protein is a recombinant human CCL5(S24-S91) protein expressed by E. coli. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 7-12 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |