Cat. No.: IBDP-531263
Size:
Online InquiryTarget Information
| Sequence | NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESAL WDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC |
| Sequence Similarities | Contains 9 SRCR domains. |
| Amino Acids | 78 to 168 |
| Cellular Localization | Secreted and Cell membrane. Isoform 1 and isoform 2 show a lower surface expression when expressed in cells. |
| Tissue Specificity | Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood. |
| Function | Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Protein Length | Protein fragment |
| Molecular Weight | 36 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |