Recombinant Human CD32A Protein

Target Information

Sequence	QAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPT HTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQ EGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGD YHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVDHHHHHH
Sequence Similarities	Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Amino Acids	36 to 218
Cellular Localization	Cell membrane.
Tissue Specificity	Found on monocytes, neutrophils and eosinophil platelets.
Function	Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Protein fragment
Molecular Weight	22 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -80 °C.
Handling	Avoid freeze / thaw cycle.