Cat. No.: IBDP-530761
Size:
Online InquiryTarget Information
| Sequence | APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHT QPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEG ETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYH CTGNIGYTLYSSKPVTITVQAP |
| Sequence Similarities | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Amino Acids | 46 to 217 |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells. |
| Function | Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | Avi, His |
| Protein Length | Protein fragment |
| Molecular Weight | 23 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -80 °C. |
| Handling | Avoid freeze / thaw cycle. |