Cat. No.: IBDP-531612
Size:
Online InquiryTarget Information
| Sequence | REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGS RERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSP LPSDFLIRHH |
| Sequence Similarities | Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. Contains 9 cadherin domains. Contains 8 EGF-like domains. Contains 1 GPS domain. Contains 1 laminin EGF-like domain. Contains 2 laminin G-like domains. |
| Amino Acids | 71 to 180 |
| Cellular Localization | Cell membrane. |
| Function | Receptor that may have an important role in cell/cell signaling during nervous system formation. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Protein fragment |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |