Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CLEC4C Protein

Cat. No.: IBDP-531336

Size:

Target Information

Synonyms CLEC4C|||BDCA2|||CLECSF11|||CLECSF7|||DLEC|||HECL|||UNQ9361/PRO34150C-type lectin domain family 4 member C|||Blood dendritic cell antigen 2|||BDCA-2|||C-type lectin superfamily member 7|||Dendritic lectin|||CD antigen CD303
Sequence NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Product Details

Product Type Protein
Species Human
Source E. coli
Tag SUMO, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 36.0 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.