Recombinant Human CLEC5A Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMGSPQIFNKSNDGFTTTRSYGTVSQIFGSS SPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGS TLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTN QNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Sequence Similarities	Contains 1 C-type lectin domain.
Amino Acids	28 to 188
Cellular Localization	Cell membrane.
Tissue Specificity	Expressed in peripheral blood monocytes and in the monocyte/macrophage cell lines U-937 and Mono-Mac-6, but not in cell lines of other origins. Expression is down-regulated when monocytes differentiate into dendritic cells.
Function	Functions as a positive regulator of osteoclastogenesis. Cell surface receptor that signals via TYROBP. Regulates inflammatory responses. Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation (By similarity). Critical macrophage receptor for dengue virus serotypes 1-4. The binding of dengue virus to CLEC5A triggers signaling through the phosphylation of TYROBP, this interaction does not result in viral entry, but stimulates proinflammatory cytokine release.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Protein fragment
Molecular Weight	21 kDa
Purity	>80%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.