Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Cripto1/CRIPTO Protein

Cat. No.: IBDP-530492

Size:

Target Information

Sequence LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNR TCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSL CKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART
Sequence Similarities Contains 1 EGF-like domain.
Amino Acids 31 to 172
Cellular Localization Cell membrane.
Tissue Specificity Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
Function Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 43 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.