Cat. No.: IBDP-530492
Size:
Online InquiryTarget Information
Sequence | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNR TCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSL CKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART |
Sequence Similarities | Contains 1 EGF-like domain. |
Amino Acids | 31 to 172 |
Cellular Localization | Cell membrane. |
Tissue Specificity | Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. |
Function | Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 43 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |