Cat. No.: IBDP-530492
Size:
Online InquiryTarget Information
| Sequence | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNR TCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSL CKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSART |
| Sequence Similarities | Contains 1 EGF-like domain. |
| Amino Acids | 31 to 172 |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. |
| Function | Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 43 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |