Recombinant Human Cripto1/CRIPTO Protein

Target Information

Sequence	MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSI WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSF YGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
Sequence Similarities	Contains 1 EGF-like domain.
Amino Acids	31 to 150
Cellular Localization	Cell membrane.
Tissue Specificity	Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
Function	Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Protein Length	Full length protein
Molecular Weight	17 kDa
Purity	>90%
Active	Yes
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.