Cat. No.: IBDP-530235
Size:
Online InquiryTarget Information
| Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDP DAPRIKKIVQKKLAGDESAD |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 59 to 128 |
| Cellular Localization | Secreted. |
| Function | LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 8 kDa |
| Purity | ≥95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |