Recombinant Human CXCL9 Protein

Target Information

Sequence	TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQ TCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQK KTT
Sequence Similarities	Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids	23 to 125
Cellular Localization	Secreted.
Function	Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	12 kDa
Purity	>95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	Biological Activity, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.