Recombinant Human Dectin-1 Protein

Target Information

Sequence	MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVIL GILCLVILVIAVVLGTMAGFKAVEFKG
Sequence Similarities	Contains 1 C-type lectin domain.
Amino Acids	1 to 77
Cellular Localization	Cytoplasm and Cell membrane.
Tissue Specificity	Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
Function	Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Tag	GST
Protein Length	Full length protein
Animal free	No
Nature	Recombinant
Application	ELISA, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.