Recombinant Human DECTIN 2 Protein

Target Information

Sequence	IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLI STKENFWSTS EQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLS DPQGNGKWQWIDDTPFSQNVRF WHPHEPNLPEERCVSIVYWNPSKWGW NDVFCDSKHNSICEMKKIYL
Sequence Similarities	Contains 1 C-type lectin domain.
Amino Acids	44 to 209
Cellular Localization	Membrane.
Tissue Specificity	Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids.
Function	Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	<0.1 Eu/μg
Protein Length	Protein fragment
Molecular Weight	55 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.