Cat. No.: IBDP-531456
Size:
Online InquiryTarget Information
| Sequence | IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLI STKENFWSTS EQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLS DPQGNGKWQWIDDTPFSQNVRF WHPHEPNLPEERCVSIVYWNPSKWGW NDVFCDSKHNSICEMKKIYL |
| Sequence Similarities | Contains 1 C-type lectin domain. |
| Amino Acids | 44 to 209 |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather than myeloids. |
| Function | Binds high-mannose carbohydrates in a Ca(2+)-dependent manner. Functional receptor for alpha-mannans on C.albicans hypheas. Plays an important role in the host defense against C.albicans infection by inducing TH17 cell differentiation. Recognizes also, in a mannose-dependent manner, allergens from house dust mite and fungi, by promoting cysteinyl leukotriene production. Recognizes soluble elements from the eggs of Shistosoma mansoni altering adaptive immune responses. Transduces signals through an Fc receptor gamma chain /FCER1G and Syk-CARD9-NF-kappa-B-dependent pathway. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | <0.1 Eu/μg |
| Protein Length | Protein fragment |
| Molecular Weight | 55 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |