Recombinant Human EBI3 Protein

Target Information

Sequence	RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPV SFIATYRL GMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSF VP FITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYW IRYKRQGAARFHRV GPIEATSFILRAVRPRARYYVQVAAQDLTDYGEL SDWSLPATATMSLGK
Sequence Similarities	Belongs to the type I cytokine receptor family. Type 3 subfamily. Contains 2 fibronectin type-III domains.
Amino Acids	21 to 229
Cellular Localization	Secreted.
Function	Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Full length protein
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE, WB

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.