Cat. No.: IBDP-531092
Size:
Online InquiryTarget Information
| Sequence | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTV EACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLK MYQVEFKTMN AKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTK IKLCILLHAF RIRAVTIDRVMSYLNAS |
| Sequence Similarities | Belongs to the type I cytokine receptor family. Type 3 subfamily. Contains 2 fibronectin type-III domains. |
| Amino Acids | 57 to 253 |
| Cellular Localization | Secreted. |
| Function | Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | CHO Cells |
| Endotoxin Level | <0.06 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 23 kDa |
| Purity | ≥98% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |