Recombinant Human ECSIT Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMGSGTCGAALTGTSISQVPLPKDSTGAADP PQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCVYYHILRADL LPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEGPVFAM CMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEE PPLPEDHQEEDDNLQRQQQGQS
Sequence Similarities	Belongs to the ECSIT family.
Amino Acids	19 to 217
Cellular Localization	Cytoplasm. Nucleus. Mitochondrion.
Function	Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development (By similarity). Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Protein fragment
Molecular Weight	25 kDa
Purity	>90%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.