Cat. No.: IBDP-530619
Size:
Online InquiryTarget Information
| Sequence | AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK PGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Sequence Similarities | Contains 1 WAP domain. |
| Amino Acids | 23 to 117 |
| Cellular Localization | Secreted. |
| Function | Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | His |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 10 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |