Recombinant Human FGFR3 Protein

Target Information

Sequence	ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPT VWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFS VRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTV RFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSD RGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVE FHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELE VLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSV YAG
Sequence Similarities	Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain.
Amino Acids	23 to 375
Cellular Localization	Membrane.
Tissue Specificity	Expressed in brain, kidney and testis. Very low or no expression in spleen, heart, and muscle. In 20- to 22-week old fetuses it is expressed at high level in kidney, lung, small intestine and brain, and to a lower degree in spleen, liver, and muscle. Isoform 2 is detected in epithelial cells. Isoform 1 is not detected in epithelial cells. Isoform 1 and isoform 2 are detected in fibroblastic cells.
Function	Receptor for acidic and basic fibroblast growth factors. Preferentially binds FGF1.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Protein fragment
Purity	≥95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.