Recombinant Human GADD45G/DDIT2 Protein

Target Information

Synonyms	rHuGrowth arrest and DNA damage-inducible protein GADD45 gamma/GADD45G, His|||Growth Arrest and DNA Damage-Inducible Protein GADD45 Gamma|||Cytokine-Responsive Protein CR6|||DNA Damage-Inducible Transcript 2 Protein|||DDIT-2|||GADD45G|||CR6|||DDIT2
Sequence	MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	6*His
Endotoxin Level	<1.0 Eu/µg
Molecular Weight	21.0 kDa
Purity	≥95%

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.