Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human GDNF Protein

Cat. No.: IBDP-530804

Size:

Target Information

Synonyms Glial cell line-derived neurotrophic factor|||ATF|||HFB1-GDNF|||HGDNF|||HSCR3
Sequence RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Function Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein (HEK293) is produced in HEK293 cells, and consists of 103 amino acids (R83-I185).

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 18 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.