Cat. No.: IBDP-530997
Size:
Online InquiryTarget Information
| Sequence | SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCH RSKCGMCCKT |
| Sequence Similarities | Belongs to the hepcidin family. |
| Amino Acids | 25 to 84 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Highest expression in liver and to a lesser extent in heart and brain. Low levels in lung, tonsils, salivary gland, trachea, prostate gland, adrenal gland and thyroid gland. Secreted into the urine. |
| Function | Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.Has strong antimicrobial activity against E.coli ML35P N.cinerea and weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Protein Length | Full length protein |
| Molecular Weight | 32 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |