Recombinant Human Iba1 Protein

Target Information

Sequence	SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFK EKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETF SYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Sequence Similarities	Contains 2 EF-hand domains.
Amino Acids	2 to 147
Cellular Localization	Cytoplasm > cytoskeleton. Cell projection > ruffle membrane. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.
Tissue Specificity	Detected in T-lymphocytes and peripheral blood mononuclear cells.
Function	Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Endotoxin Level	≥1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	18 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.