Recombinant Human ICEBERG Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMADQLLRKKRRIFIHSVGAGTINALLDCLL EDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEED PQLASKMGLH
Sequence Similarities	Contains 1 CARD domain.
Amino Acids	1 to 90
Tissue Specificity	Primarily expressed in the heart and placenta.
Function	Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Full length protein
Molecular Weight	12 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.