Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IGF1 Protein

Cat. No.: IBDP-530275

Size:

Target Information

Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA
Sequence Similarities Belongs to the insulin family.
Amino Acids 49 to 118
Cellular Localization Secreted.
Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Fc Tag
Endotoxin Level <1.0 Eu/µg
Protein Length Full length protein
Molecular Weight 35 kDa
Purity >98%
Active Yes
Animal free No
Nature Recombinant
Application ELISA, FuncS, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.