Cat. No.: IBDP-530275
Size:
Online InquiryTarget Information
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA |
| Sequence Similarities | Belongs to the insulin family. |
| Amino Acids | 49 to 118 |
| Cellular Localization | Secreted. |
| Function | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | Fc Tag |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 35 kDa |
| Purity | >98% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |