Cat. No.: IBDP-531558
Size:
Online InquiryTarget Information
| Sequence | MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQV LLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKI QIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAK IAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPG GTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH |
| Sequence Similarities | Belongs to the RRM IMP/VICKZ family. Contains 4 KH domains. Contains 2 RRM (RNA recognition motif) domains. |
| Amino Acids | 1 to 220 |
| Cellular Localization | Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Localizes at the connecting piece and the tail of the spermatozoa. |
| Tissue Specificity | Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bone marrow, colon, kidney, salivary glands, testis and pancreas. Detected in fetal liver, fetal ovary, gonocytes and interstitial cells of the testis. |
| Function | Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. May regulate translation of target mRNAs. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | His, T7 Tag |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 27 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |