Recombinant Human IL-20R1 Protein

Target Information

Sequence	VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQK KWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRF YPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNL KYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRA QPSEKQCARTLKDQSSEFKAKVDHHHHHH
Sequence Similarities	Belongs to the type II cytokine receptor family. Contains 2 fibronectin type-III domains.
Amino Acids	30 to 250
Cellular Localization	Membrane.
Tissue Specificity	Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.
Function	The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Protein fragment
Molecular Weight	26 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -80 °C.
Handling	Avoid freeze / thaw cycle.