Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-22 Protein

Cat. No.: IBDP-531434

Size:

Target Information

Synonyms rHuIL-22|||Cytokine Zcyto 18|||IL-TIF
Sequence MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Function IL-22 Protein is a cytokine protein and intricate member of the immune response.

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <0.2 Eu/μg
Molecular Weight 16.9 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.