Cat. No.: IBDP-530377
Size:
Online InquiryTarget Information
| Synonyms | Interleukin-3|||IL-3|||Hematopoietic Growth Factor|||Mast Cell Growth Factor|||MCGF|||Multipotential Colony-Stimulating Factor|||P-Cell-Stimulating Factor|||IL3 |
| Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Function | IL-3 Protein (HEK293, His) is a multipotent hematopoietic growth factor that can control blood formation. IL-3 Protein (HEK293, His) is a recombinant human interleukin-3 (rhIL-3) expressed in HEK 293 cells with a His tag. rhIL-3 is also a weak inflammatory mediator. rhIL-3 can be used to improve states of hematopoietic failure. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 17-30 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |