Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human IL-9 Protein

Cat. No.: IBDP-530539

Size:

Target Information

Synonyms rHuIL-9|||Cytokine P40|||T-cell Growth Factor P40
Sequence QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Function IL-9 Protein (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.

Product Details

Product Type Protein
Species Human
Source CHO Cells
Tag Tag Free
Endotoxin Level <0.2 Eu/μg
Molecular Weight 25-40 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.