Cat. No.: IBDP-531662
Size:
Online InquiryTarget Information
| Sequence | MGSSHHHHHHSSGLVPRGSHMKETLKIVSRTPVNITMAGDSGNGMSTFIS ALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTL ENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMD LSTGALPEVQLLQIRENVLENLQKERVCEY |
| Sequence Similarities | Belongs to the interferon-inducible GTPase family. |
| Amino Acids | 23 to 181 |
| Cellular Localization | Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle > phagosome membrane. Cytoplasmic vesicle > autophagosome membrane. Cell projection > phagocytic cup. Behaves like an integral membrane protein (By similarity). Recruited to the plasma membrane around forming phagocytic cups, it remains associated with maturing autophagosomes (By similarity). Preferentially associated with cis- and medial-Golgi. |
| Tissue Specificity | Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes. |
| Function | Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | His |
| Protein Length | Protein fragment |
| Molecular Weight | 20 kDa |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |