Recombinant Human IRGM Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMKETLKIVSRTPVNITMAGDSGNGMSTFIS ALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTL ENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMD LSTGALPEVQLLQIRENVLENLQKERVCEY
Sequence Similarities	Belongs to the interferon-inducible GTPase family.
Amino Acids	23 to 181
Cellular Localization	Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle > phagosome membrane. Cytoplasmic vesicle > autophagosome membrane. Cell projection > phagocytic cup. Behaves like an integral membrane protein (By similarity). Recruited to the plasma membrane around forming phagocytic cups, it remains associated with maturing autophagosomes (By similarity). Preferentially associated with cis- and medial-Golgi.
Tissue Specificity	Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.
Function	Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Protein fragment
Molecular Weight	20 kDa
Purity	>90%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.