Recombinant Human KGF/FGF-7 Protein

Target Information

Sequence	CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDK RGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKK ECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT
Sequence Similarities	Belongs to the heparin-binding growth factors family.
Amino Acids	32 to 194
Cellular Localization	Secreted.
Tissue Specificity	Epithelial cell.
Function	Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	19 kDa
Purity	>95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	Cell Culture, FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.