Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human LDHA Protein

Cat. No.: IBDP-530168

Size:

Target Information

Synonyms rHuL-lactate dehydrogenase A chain/LDH-A, His|||L-Lactate Dehydrogenase A Chain|||LDH-A|||Cell Proliferation-Inducing Gene 19 Protein|||LDH Muscle Subunit|||LDH-M|||Renal Carcinoma Antigen NY-REN-59|||LDHA
Sequence MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 38.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.