Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human LMW-PTP/ACP1 Protein

Cat. No.: IBDP-530681

Size:

Target Information

Synonyms rHuLow molecular weight phosphotyrosine protein phosphatase/LMW-PTP, His|||Low Molecular Weight Phosphotyrosine Protein Phosphatase|||LMW-PTP|||LMW-PTPase|||Adipocyte Acid Phosphatase|||Low Molecular Weight Cytosolic Acid Phosphatase|||Red Cell Acid Phosphatase 1|||ACP1
Sequence AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 18.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.