Cat. No.: IBDP-530857
Size:
Online InquiryTarget Information
| Sequence | GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADP QATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
| Sequence Similarities | Belongs to the intercrine gamma family. |
| Amino Acids | 23 to 114 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine. |
| Function | Chemotactic activity for lymphocytes but not for monocytes or neutrophils. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 10 kDa |
| Purity | >97% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |