Cat. No.: IBDP-531668
Size:
Online InquiryTarget Information
| Sequence | KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR STDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVV |
| Sequence Similarities | Belongs to the glycosyl hydrolase 22 family. |
| Amino Acids | 19 to 118 |
| Cellular Localization | Secreted. |
| Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Protein fragment |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |