Cat. No.: IBDP-531668
Size:
Online InquiryTarget Information
Sequence | KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDR STDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVV |
Sequence Similarities | Belongs to the glycosyl hydrolase 22 family. |
Amino Acids | 19 to 118 |
Cellular Localization | Secreted. |
Function | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. |
Product Details
Product Type | Protein |
Species | Human |
Source | Wheat Germ |
Tag | GST |
Protein Length | Protein fragment |
Animal free | No |
Nature | Recombinant |
Application | ELISA, WB |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |