Products
  1. Home
  2. Products
  3. Proteins & Peptides for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human LYVE-1 Protein

Cat. No.: IBDP-532775

Size:

Target Information

Synonyms rHuLymphatic vessel endothelial hyaluronic acid receptor 1/LYVE-1, His|||Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1|||LYVE-1|||Cell Surface Retention Sequence-Binding Protein 1|||CRSBP-1|||Extracellular Link Domain-Containing Protein 1|||Hyaluronic Acid Receptor|||LYVE1|||CRSBP1|||HAR|||XLKD1
Sequence LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40-60 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.