Cat. No.: IBDP-531669
Size:
Online InquiryTarget Information
| Sequence | MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVK RLKPLFNKSF |
| Amino Acids | 1 to 60 |
| Cellular Localization | Lysosome membrane. |
| Function | Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Protein Length | Protein fragment |
| Purity | >90% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |