Recombinant Human M6PR (cation dependent) Protein

Target Information

Sequence	MGSSHHHHHHSSGLVPRGSHMGSTEEKTCDLVGEKGKESEKELALVKRLK PLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVV GRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADN FNPVSEERGKVQDCFYLFEMDSSLACSPEISH
Amino Acids	27 to 185
Cellular Localization	Lysosome membrane.
Function	Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Protein fragment
Molecular Weight	20 kDa
Purity	>85%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.