Cat. No.: IBDP-531561
Size:
Online InquiryTarget Information
| Sequence | QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPR RDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTIS FSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN |
| Amino Acids | 19 to 160 |
| Cellular Localization | Secreted > extracellular space. |
| Function | Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Full length protein |
| Molecular Weight | 41 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |