Recombinant Human MKK7 Protein

Target Information

Sequence	MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLAND GGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEI
Sequence Similarities	Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. Contains 1 protein kinase domain.
Amino Acids	1 to 99
Cellular Localization	Nucleus. Cytoplasm.
Tissue Specificity	Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle.
Function	Stress activated, dual specificity kinase that activates the JUN kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Tag	GST
Protein Length	Protein fragment
Animal free	No
Nature	Recombinant
Application	ELISA, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.