Cat. No.: IBDP-530270
Size:
Online InquiryTarget Information
| Sequence | APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLE LRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWK TVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPL AHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELE QSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVS FPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFL EPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPF EFNPEDPIPVSFSPVDTNSTSGDP |
| Sequence Similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 protein kinase domain. |
| Amino Acids | 34 to 407 |
| Cellular Localization | Cell membrane. Early endosome membrane. Late endosome membrane. Internalized to endosomes upon binding of NGF or NTF3 and further transported to the cell body via a retrograde axonal transport. Localized at cell membrane and early endosomes before nerve growth factor (NGF) stimulation. Recruited to late endosomes after NGF stimulation. Colocalized with RAPGEF2 at late endosomes (By similarity). |
| Tissue Specificity | Isoform TrkA-I is found in most non-neuronal tissues. Isoform TrkA-II is primarily expressed in neuronal cells. TrkA-III is specifically expressed by pluripotent neural stem and neural crest progenitors. |
| Function | Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand, it can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival. Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors.Isoform TrkA-III is resistant to NGF, constitutively activates AKT1 and NF-kappa-B and is unable to activate the Ras-MAPK signaling cascade. Antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes neuronal precursors differentiation. Isoform TrkA-III promotes angiogenesis and has oncogenic activity when overexpressed. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 41 kDa |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |